Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Adenosine receptor A2a (ADORA2A)

This Recombinant Horse Adenosine receptor A2a (ADORA2A) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Adenosine receptor A2a

UniProt

Q6TLI7

Expression Region

1-412

Origin

Equus caballus (Horse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTVGSLVYIMVELAIALLAILGNMLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR AKGVIAVCWVLSFAIGLTPMLGWNNCHHWGEGENQSQGCGEGQVACLFEDVVPMNYMVYY NFFACVLVPLLLMLGVYLRIFLAARRQLKQMETQPLPGERARSTLQKEVHAAKSLAIIVG LFALCWLPLHIINCFTFFCPECPHAPLWLMYPAIILSHFNSVVNPFIYAYRIREFRHTFH KIIRSHILRRQEPFKAGGTSARALAAHGSDAEQVSLRLNGHPSGVCPNGSAPHPERRPNG YALGLVSRASARESPGDTGLPDVELLSHELHGASPESPGLEGPLAQDGAGVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCRL2 (NM_001130910) Human Over-expression Lysate
LC427300 20 µg

CCRL2 (NM_001130910) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: left
CP565787 150 µg

Tissue Protein Lysate, Ovary: left

Sign In for Pricing
View Details
Recombinant Rat Ifna2 Protein (Sumo Tag)
PDER100258-01 20 µg

Recombinant Rat Ifna2 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat Ifna2 Protein (Sumo Tag)
PDER100258-02 100 µg

Recombinant Rat Ifna2 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat Ifna2 Protein (Sumo Tag)
PDER100258-03 500 µg

Recombinant Rat Ifna2 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat Ifna2 Protein (Sumo Tag)
PDER100258-04 1 mg

Recombinant Rat Ifna2 Protein (Sumo Tag)

Sign In for Pricing
View Details