Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Motilin receptor (MLNR)

This Recombinant Human Motilin receptor (MLNR) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Motilin receptor, G-protein coupled receptor 38

UniProt

O43193

Expression Region

1-412

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTV MLIGRYRDMRTTTNLYLGSMAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEG CTYATLLHMTALSVERYLAICRPLRARVLVTRRRVRALIAVLWAVALLSAGPFLFLVGVE QDPGISVVPGLNGTARIASSPLASSPPLWLSRAPPPSPPSGPETAEAAALFSRECRPSPA QLGALRVMLWVTTAYFFLPFLCLSILYGLIGRELWSSRRPLRGPAASGRERGHRQTVRVL LVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQLFYLSASINPILYNLISK KYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGDTVGYTETSANVKTMG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS629885 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI3H1]
CF806185 100 µg

Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI3H1]

Sign In for Pricing
View Details
PLEKHA3 (NM_019091) Human Over-expression Lysate
LY402733 100 µg

PLEKHA3 (NM_019091) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lambda Light Chain (ICO-106), CF594 conjugate, 0.1mg/mL
BNC940019-100 1x 100 µL

Human Lambda Light Chain (ICO-106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Snrpd1 Mouse Gene Knockout Kit (CRISPR)
KN516405 1 Kit

Snrpd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Pellino 2 (PELI2) activation kit by CRISPRa
GA111418 1 Kit

Human Pellino 2 (PELI2) activation kit by CRISPRa

Sign In for Pricing
View Details