Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 184A (TMEM184A)

This Recombinant Human Transmembrane protein 184A (TMEM184A) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Transmembrane protein 184A

UniProt

Q6ZMB5

Expression Region

1-413

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGAPWLFLTSALARGVSG IFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYF DSVRDCYEAFVIYSFLSLCFQYLGGEGAIMAEIRGKPIKSSCLYGTCCLRGMTYSIGFLR FCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLYVTLIYNASVSLALYALFL FYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPEVETSGGNKLGAGTL AAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIV QDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), CF640R conjugate, 0.1mg/mL
BNC400014-100 1x 100 µL

CD31 / PECAM-1 (C31.7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL
BNC740018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468), CF594 conjugate, 0.1mg/mL
BNC940468-100 1x 100 µL

CD8 (C8/468), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (H+L) (RT-97 + NR-4), CF740 conjugate, 0.1mg/mL
BNC741201-500 1x 500 µL

Neurofilament (H+L) (RT-97 + NR-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details