Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative odorant receptor 7a (Or7a)

This Recombinant Drosophila melanogaster Putative odorant receptor 7a (Or7a) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Putative odorant receptor 7a

UniProt

Q9W3I5

Expression Region

1-413

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVSTRVATKQEVPESRRAFRNLFNCFYALGMQAPDGSRPTTSSTWQRIYACFSVVMYVW QLLLVPTFFVISYRYMGGMEITQVLTSAQVAIDAVILPAKIVALAWNLPLLRRAEHHLAA LDARCREQEEFQLILDAVRFCNYLVWFYQICYAIYSSSTFVCAFLLGQPPYALYLPGLDW QRSQMQFCIQAWIEFLIMNWTCLHQASDDVYAVIYLYVVRIQVQLLARRVEKLGTDDSGQ VEIYPDERRQEEHCAELQRCIVDHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINI FIFANTNTKIASIIYLLAVTLQTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKML LYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLIKGMNLGERFNRTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF568 conjugate, 0.1mg/mL
BNC681628-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF568 conjugate, 0.1mg/mL
BNC681203-100 1x 100 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF640R conjugate, 0.1mg/mL
BNC401648-100 1x 100 µL

TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details