Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Prostacyclin receptor (Ptgir)

This Recombinant Rat Prostacyclin receptor (Ptgir) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Prostacyclin receptor, Prostaglandin I2 receptor, PGI receptor, PGI2 receptor, Prostanoid IP receptor

UniProt

P43253

Expression Region

1-413

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASGGRPDGPPSITPESPLIVGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGN GLALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTML CDTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARLALPAIYAFCCLFC SLPLLGLGEHQQYCPGSWCFIRMRSPQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLC HMYRQQRRHHGSFVPTSRAREDEVYHLILLALMTGIMAVCSLPLTIRGFTQAIAPDSREM GDLHAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQTPLSRPVSGRRD TLAPDSLQAKEGNWVPLSTWGTGQVAPLTAVPLSGGDGCSVGMPSKTEAVVAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF405S conjugate, 0.1mg/mL
BNC040768-500 1x 500 µL

GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details