Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 184A (TMEM184A)

This Recombinant Bovine Transmembrane protein 184A (TMEM184A) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Transmembrane protein 184A

UniProt

Q1RMW2

Expression Region

1-414

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDTPGLLGTPLAWTPPARPAGPQMERAGNGSQGPGPLFLTSPLARGVSGVFVWAALVLT GHQIYLHLRSYTVPHEQRYIIRLLFIVPVYAFDSWLSLLLLGGHQHYIYFDSVRDCYEAF VIYSFLSLCFQYLGGESAIMAEIRGKPVRTSCFHGTCCLRGMTYSIGFLRFCKQATLQFC IVKPIMALVTIVLQAFGKYHDGDFNVRSGYLYITLVYNASVSLALYALFLFYSATRELLQ PFEPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPEVQVIDGSTVGAGTVAAGYQNFIIC IEMLFASIALRYAFTCQVYSEKTESSPAPSAPMQSISSGLKETMSPQDIVQDAIHNFSPA YQKYTQQATQEAPRPGQGSVPSPRTPTHSPDGGPGGGRKGRNVEKRMLIPAEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL
BNC942349-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), Biotin conjugate, 0.1mg/mL
BNCB0175-500 1x 500 µL

CD46 (122.2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF405S conjugate, 0.1mg/mL
BNC041619-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details