Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable low-affinity inorganic phosphate transporter (pit)

This Recombinant Probable low-affinity inorganic phosphate transporter (pit) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Probable low-affinity inorganic phosphate transporter

UniProt

Q50173

Expression Region

1-414

Origin

Mycobacterium leprae

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINLFLLIIVVITALAFDFTNGFHDTGNAMATSIASGALAPKVAVFFSAILNLVGAFLS TAVAATIAKDLIEADLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGARIAA VGGHGVIWSGVISKVIIPAIIAALLAIVVGAVATWLVYAITRSVPAMSTDTRFRRGQIGS ASLVSLAHGTNDAQKTMGVIFLALMSYGTVSKTASTPPLWVIVCCAIAIAAGTYLGGWRI IRTLGKGMVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVCTGSVLGSGLGKPGGEVR WGVAGRMATAWLVTLPLAGSVGAVTYWIVHLIGGYPGAVIGFSLLVAASVAIYIRSRKVK VDHKNVNENWEGSLTAGLDGSDEHKPHSDVGPKLSATLPRYRSSHHTVGVRNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human immunoglubin joining chain (Ig-j) ELISA Kit
GA-E0210HM-01 48 Tests

Human immunoglubin joining chain (Ig-j) ELISA Kit

Sign In for Pricing
View Details
Human immunoglubin joining chain (Ig-j) ELISA Kit
GA-E0210HM-02 96 Tests

Human immunoglubin joining chain (Ig-j) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal ERp72 Antibody (001) [DyLight 405]
NBP2-90206V 0.1 mL

Rabbit Monoclonal ERp72 Antibody (001) [DyLight 405]

Sign In for Pricing
View Details
MSL3L1 Rabbit Polyclonal Antibody (FITC)
orb2126781 100 µL

MSL3L1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Protein ycf2 (ycf2), partial
MBS1086035 Inquire

Recombinant Marchantia polymorpha Protein ycf2 (ycf2), partial

Sign In for Pricing
View Details
STAT3 (phospho-Tyr705)
MBS191057-01 0.1 mL

STAT3 (phospho-Tyr705)

Sign In for Pricing
View Details