Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable low-affinity inorganic phosphate transporter (pit)

This Recombinant Probable low-affinity inorganic phosphate transporter (pit) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Probable low-affinity inorganic phosphate transporter

UniProt

Q50173

Expression Region

1-414

Origin

Mycobacterium leprae

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINLFLLIIVVITALAFDFTNGFHDTGNAMATSIASGALAPKVAVFFSAILNLVGAFLS TAVAATIAKDLIEADLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGARIAA VGGHGVIWSGVISKVIIPAIIAALLAIVVGAVATWLVYAITRSVPAMSTDTRFRRGQIGS ASLVSLAHGTNDAQKTMGVIFLALMSYGTVSKTASTPPLWVIVCCAIAIAAGTYLGGWRI IRTLGKGMVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVCTGSVLGSGLGKPGGEVR WGVAGRMATAWLVTLPLAGSVGAVTYWIVHLIGGYPGAVIGFSLLVAASVAIYIRSRKVK VDHKNVNENWEGSLTAGLDGSDEHKPHSDVGPKLSATLPRYRSSHHTVGVRNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pepper cDNA
PLD-1043 30 Reactions

Pepper cDNA

Sign In for Pricing
View Details
FRS2 3'UTR GFP Stable Cell Line
TU058299 1.0 mL

FRS2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HNRPLL Rabbit Polyclonal Antibody (FITC)
orb2124357 100 µL

HNRPLL Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Myf6 Mouse Gene Knockout Kit (CRISPR)
KN510587 1 Kit

Myf6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PASK Protein Vector (Human) (pPM-C-His)
PV030160 500 ng

PASK Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human CXCL2/MIP-2 Protein
PKSH033705-01 20 µg

Recombinant Human CXCL2/MIP-2 Protein

Sign In for Pricing
View Details