Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Beta-2 adrenergic receptor (ADRB2)

This Recombinant Macaca mulatta Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q28509

Expression Region

1-415

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNGSAFLLAPNGSHAPDHDVTQERDEAWVVGMGIVMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF HAQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKACGNGYSSNSNG NTGEQSGYHLEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRSCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Integrin Alpha 2 ELISA Kit
MBS089682-01 48 Well

Hamster Integrin Alpha 2 ELISA Kit

Sign In for Pricing
View Details
Hamster Integrin Alpha 2 ELISA Kit
MBS089682-02 96 Well

Hamster Integrin Alpha 2 ELISA Kit

Sign In for Pricing
View Details
Hamster Integrin Alpha 2 ELISA Kit
MBS089682-03 5x 96 Well

Hamster Integrin Alpha 2 ELISA Kit

Sign In for Pricing
View Details
Hamster Integrin Alpha 2 ELISA Kit
MBS089682-04 10x 96 Well

Hamster Integrin Alpha 2 ELISA Kit

Sign In for Pricing
View Details
Pectinase Rabbit pAb, BF700 conjugated
orb2887305 100 µL

Pectinase Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Nkx 2.8 Mid (Nk2 Transcription Factor Related Locus 8, NKX2H, NKX2.8, Nkx2-9) (MaxLight 550) discontinued
N2850-23-ML550 100 µL

Nkx 2.8 Mid (Nk2 Transcription Factor Related Locus 8, NKX2H, NKX2.8, Nkx2-9) (MaxLight 550) discontinued

Sign In for Pricing
View Details