Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Beta-2 adrenergic receptor (ADRB2)

This Recombinant Macaca mulatta Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q28509

Expression Region

1-415

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNGSAFLLAPNGSHAPDHDVTQERDEAWVVGMGIVMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF HAQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKACGNGYSSNSNG NTGEQSGYHLEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRSCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCN2 (Transcobalamin 2, TC-2, Transcobalamin II, TC II, TCII, TC2) (Biotin)
T8193-03-Biotin 100 µL

TCN2 (Transcobalamin 2, TC-2, Transcobalamin II, TC II, TCII, TC2) (Biotin)

Sign In for Pricing
View Details
Lmo2 (NM_001142335) Mouse Tagged Lenti ORF Clone
MR225099L4 10 µg

Lmo2 (NM_001142335) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TEKT2 (NM_014466) Human Recombinant Protein
TP307425M 100 µg

TEKT2 (NM_014466) Human Recombinant Protein

Sign In for Pricing
View Details
Canine Iduronate-2-Sulfatase (IDS) ELISA Kit
EIA05843Ca 1 Kit

Canine Iduronate-2-Sulfatase (IDS) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bovine Beta-arrestin-2 (ARRB2), partial
MBS957132-01 0.02 mg (Yeast)

Recombinant Bovine Beta-arrestin-2 (ARRB2), partial

Sign In for Pricing
View Details
Recombinant Bovine Beta-arrestin-2 (ARRB2), partial
MBS957132-02 0.1 mg (Yeast)

Recombinant Bovine Beta-arrestin-2 (ARRB2), partial

Sign In for Pricing
View Details