Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 19 (Gpr19)

This Recombinant Mouse Probable G-protein coupled receptor 19 (Gpr19) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 19

UniProt

Q61121

Expression Region

1-415

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVFAHRMDNDQPPVVTATLLVPLQNSSCAEAAEALLPHGLMGLHEEHSWMSNRTELQYEL NPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTP FVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKA KKMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTAYTVIHFLVGFVIPSILII LFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLLNLVFLFSWLPFHVAQLWHP HEQDYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSNAYTI TTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWPINSNPPNTFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat oxidized high density Lipoprotein, Ox-HDL GENLISA ELISA
KLR1763 96 Well

Rat oxidized high density Lipoprotein, Ox-HDL GENLISA ELISA

Sign In for Pricing
View Details
CD100 (AP)
MBS6247433-01 0.1 mL

CD100 (AP)

Sign In for Pricing
View Details
CD100 (AP)
MBS6247433-02 5x 0.1 mL

CD100 (AP)

Sign In for Pricing
View Details
Goat protein-tyrosine phosphatase 2 ELISA kit
GTR10453934 96 Well

Goat protein-tyrosine phosphatase 2 ELISA kit

Sign In for Pricing
View Details
IL19 Antibody
E19-8982-2 100 µg -100 µL

IL19 Antibody

Sign In for Pricing
View Details
Mannose 6 Phosphate Receptor/IGF2R Rabbit Polyclonal Antibody (HRP)
orb2574833 100 µg

Mannose 6 Phosphate Receptor/IGF2R Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details