Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 19 (Gpr19)

This Recombinant Mouse Probable G-protein coupled receptor 19 (Gpr19) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 19

UniProt

Q61121

Expression Region

1-415

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVFAHRMDNDQPPVVTATLLVPLQNSSCAEAAEALLPHGLMGLHEEHSWMSNRTELQYEL NPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTP FVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKA KKMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTAYTVIHFLVGFVIPSILII LFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLLNLVFLFSWLPFHVAQLWHP HEQDYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFCMSSMKCYRSNAYTI TTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWPINSNPPNTFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH2 Rabbit Monoclonal Antibody
E10G21028 100 µL

ALKBH2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB523337 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Serinc1 (NM_019760) Mouse Recombinant Protein
PM46281M5 20 µg

Serinc1 (NM_019760) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CD49b/ITGA2 Protein, N-His
orb2832453-01 20 µg

Recombinant Human CD49b/ITGA2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD49b/ITGA2 Protein, N-His
orb2832453-02 50 µg

Recombinant Human CD49b/ITGA2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD49b/ITGA2 Protein, N-His
orb2832453-03 100 µg

Recombinant Human CD49b/ITGA2 Protein, N-His

Sign In for Pricing
View Details