Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Alpha-2Db adrenergic receptor (adra2db)

This Recombinant Danio rerio Alpha-2Db adrenergic receptor (adra2db) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Alpha-2Db adrenergic receptor, Alpha-2Db adrenoceptor, Alpha (2Db) AR, Alpha-2Db adrenoreceptor

UniProt

Q8JG69

Expression Region

1-415

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLSTITFLLPNSSEDTNGTSAPRLPPHSQCASVLIVLVVTVIILVTIVGNVLVVVAVFT SRALRAPQNLFLVSLAAADILVATLVIPFSLANEVMGYWYLGSTWCAFYLALDVLFCTSS IVHLCAISLDRYWSVTKAVSYNLKRTPRRIKIMITVVWVISAVISFPPLLMTKHDELECL LNNETWYILSSCIVSFFAPGLIMILVYCRIYRVAKQRASTVFVAKNGMERQPSQSETCFV RKGKSEVESPSSHSSGSRERKGELDDIDLEESSVSNRHRNSRFAKSRKVEGAQSCPKPNG RLSWACSRASELEQEPRARQLSLSKSKLAQMREKRFTFVLAVVMGVFVLCWFPFFFTYSL HAICRKSCTIPDSLFNLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKIMCRHSTRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZP1 Human qPCR Primer Pair (NM_207341)
HP219662 200 Reactions

ZP1 Human qPCR Primer Pair (NM_207341)

Sign In for Pricing
View Details
BID (Ab-78) Antibody
8B0461-AAT 50 µg

BID (Ab-78) Antibody

Sign In for Pricing
View Details
ITPRID1 Human Gene Knockout Kit (CRISPR)
KN422688 1 Kit

ITPRID1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCDC32 (NM_001080792) Human Over-expression Lysate
LY421113 100 µg

CCDC32 (NM_001080792) Human Over-expression Lysate

Sign In for Pricing
View Details
ERp57 Recombinant Rabbit Monoclonal Antibody [JM11-44]
ET1703-68 100 µL

ERp57 Recombinant Rabbit Monoclonal Antibody [JM11-44]

Sign In for Pricing
View Details
Hsc70 Interacting Protein HIP Antibody
KC-1186-01 50 μL

Hsc70 Interacting Protein HIP Antibody

Sign In for Pricing
View Details