Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Alpha-2Db adrenergic receptor (adra2db)

This Recombinant Danio rerio Alpha-2Db adrenergic receptor (adra2db) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Alpha-2Db adrenergic receptor, Alpha-2Db adrenoceptor, Alpha (2Db) AR, Alpha-2Db adrenoreceptor

UniProt

Q8JG69

Expression Region

1-415

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLSTITFLLPNSSEDTNGTSAPRLPPHSQCASVLIVLVVTVIILVTIVGNVLVVVAVFT SRALRAPQNLFLVSLAAADILVATLVIPFSLANEVMGYWYLGSTWCAFYLALDVLFCTSS IVHLCAISLDRYWSVTKAVSYNLKRTPRRIKIMITVVWVISAVISFPPLLMTKHDELECL LNNETWYILSSCIVSFFAPGLIMILVYCRIYRVAKQRASTVFVAKNGMERQPSQSETCFV RKGKSEVESPSSHSSGSRERKGELDDIDLEESSVSNRHRNSRFAKSRKVEGAQSCPKPNG RLSWACSRASELEQEPRARQLSLSKSKLAQMREKRFTFVLAVVMGVFVLCWFPFFFTYSL HAICRKSCTIPDSLFNLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKIMCRHSTRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optional generator 14mm x 130mm saw tooth, for 50ml tubes up to 250ml vessels
D1000-M14 1 Each

Optional generator 14mm x 130mm saw tooth, for 50ml tubes up to 250ml vessels

Sign In for Pricing
View Details
Recombinant BANF1 Antibody
RC-4151-01 50 μL

Recombinant BANF1 Antibody

Sign In for Pricing
View Details
Recombinant BANF1 Antibody
RC-4151-02 100 µL

Recombinant BANF1 Antibody

Sign In for Pricing
View Details
Recombinant BANF1 Antibody
RC-4151-03 1 mL

Recombinant BANF1 Antibody

Sign In for Pricing
View Details
Fmoc-Trp (Boc) Wang Resin
H0370751328.25G 25 g

Fmoc-Trp (Boc) Wang Resin

Sign In for Pricing
View Details
G-CSF Receptor Antibody
KC-1677-01 50 μL

G-CSF Receptor Antibody

Sign In for Pricing
View Details