Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoforms A/C (Gr23a)

This Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoforms A/C (Gr23a) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Putative gustatory receptor 23a, isoforms A/C

UniProt

Q9VQE7

Expression Region

1-415

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLECLTRRFLEVIFSVLALVPLPPISQLGWLFLSLAIRCCWIVYFIYLLDVAISFSWV AIENVGNAVGTMLFVGNSVLGFALLLESVLKQKTHSQLEDLRVQTELQLQRLGMFGRSRH AAYLLPLIGVQFTCDLVRLATNFGETVSPVFCISLPLMWLLRYRYVQLVQHVMDLNQRSI HLRRSLLSMASGNDLWQPYGVQECLQLQTLRTTYERIFECYETFSDCYGWGMLGLHLLTS FQFVTNAYWMIMGIYDGGNVRSLIFNGATGIDFGTPIATLFWHGDSGAENNQAGPVGRTD CVRGLRSLVGLHCAGDAGSHFGSRVFGVLERARICLSYQDLSPENAAQFSGSAGADYILY PGGHEGEHKGFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMFAERSSTRGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF Antibody
orb420293 100 µL

TNF Antibody

Sign In for Pricing
View Details
DNAH6 Lentiviral Activation Particles (h2)
sc-409605-LAC-2 200 µL

DNAH6 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
GATA3 (GATA Binding Factor 3, HDR, HDRS) (AP)
MBS6418213-01 0.1 mL

GATA3 (GATA Binding Factor 3, HDR, HDRS) (AP)

Sign In for Pricing
View Details
GATA3 (GATA Binding Factor 3, HDR, HDRS) (AP)
MBS6418213-02 5x 0.1 mL

GATA3 (GATA Binding Factor 3, HDR, HDRS) (AP)

Sign In for Pricing
View Details
Beta-defensin 1
307874-01 50 µg

Beta-defensin 1

Sign In for Pricing
View Details
Beta-defensin 1
307874-02 100 µg

Beta-defensin 1

Sign In for Pricing
View Details