Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoforms A/C (Gr23a)

This Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoforms A/C (Gr23a) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Putative gustatory receptor 23a, isoforms A/C

UniProt

Q9VQE7

Expression Region

1-415

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLECLTRRFLEVIFSVLALVPLPPISQLGWLFLSLAIRCCWIVYFIYLLDVAISFSWV AIENVGNAVGTMLFVGNSVLGFALLLESVLKQKTHSQLEDLRVQTELQLQRLGMFGRSRH AAYLLPLIGVQFTCDLVRLATNFGETVSPVFCISLPLMWLLRYRYVQLVQHVMDLNQRSI HLRRSLLSMASGNDLWQPYGVQECLQLQTLRTTYERIFECYETFSDCYGWGMLGLHLLTS FQFVTNAYWMIMGIYDGGNVRSLIFNGATGIDFGTPIATLFWHGDSGAENNQAGPVGRTD CVRGLRSLVGLHCAGDAGSHFGSRVFGVLERARICLSYQDLSPENAAQFSGSAGADYILY PGGHEGEHKGFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMFAERSSTRGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Ephrin-A1 Antibody (453) [Allophycocyanin]
NBP2-89692APC 0.1 mL

Rabbit Monoclonal Ephrin-A1 Antibody (453) [Allophycocyanin]

Sign In for Pricing
View Details
CSNK1G1 Polyclonal Antibody, HRP Conjugated
bs-12424R-HRP 100 µL

CSNK1G1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Lentiviral human GANAB shRNA (UAS) - Lentiviral human GANAB shRNA (UAS) (25)
GTR15153125 1 Vial

Lentiviral human GANAB shRNA (UAS) - Lentiviral human GANAB shRNA (UAS) (25)

Sign In for Pricing
View Details
TARBP2 Polyclonal Antibody
orb618147-01 50 μL

TARBP2 Polyclonal Antibody

Sign In for Pricing
View Details
TARBP2 Polyclonal Antibody
orb618147-02 100 µL

TARBP2 Polyclonal Antibody

Sign In for Pricing
View Details
RHBDF2 Antibody
orb752693-01 50 μL

RHBDF2 Antibody

Sign In for Pricing
View Details