Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoforms A/C (Gr23a)

This Recombinant Drosophila melanogaster Putative gustatory receptor 23a, isoforms A/C (Gr23a) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Putative gustatory receptor 23a, isoforms A/C

UniProt

Q9VQE7

Expression Region

1-415

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLECLTRRFLEVIFSVLALVPLPPISQLGWLFLSLAIRCCWIVYFIYLLDVAISFSWV AIENVGNAVGTMLFVGNSVLGFALLLESVLKQKTHSQLEDLRVQTELQLQRLGMFGRSRH AAYLLPLIGVQFTCDLVRLATNFGETVSPVFCISLPLMWLLRYRYVQLVQHVMDLNQRSI HLRRSLLSMASGNDLWQPYGVQECLQLQTLRTTYERIFECYETFSDCYGWGMLGLHLLTS FQFVTNAYWMIMGIYDGGNVRSLIFNGATGIDFGTPIATLFWHGDSGAENNQAGPVGRTD CVRGLRSLVGLHCAGDAGSHFGSRVFGVLERARICLSYQDLSPENAAQFSGSAGADYILY PGGHEGEHKGFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMFAERSSTRGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APRIL/TNFSF13 Rabbit Polyclonal Antibody (Biotin)
orb2591958 100 µg

APRIL/TNFSF13 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Plant Interleukin 23 (IL23) ELISA Kit
MBS9375612 Inquire

Plant Interleukin 23 (IL23) ELISA Kit

Sign In for Pricing
View Details
Interferon alpha 2 Polyclonal Antibody
bs-16617R 100 µL

Interferon alpha 2 Polyclonal Antibody

Sign In for Pricing
View Details
Human Glutamyl-tRNA (QRSL1) ELISA Kit
abx382592 96 Tests

Human Glutamyl-tRNA (QRSL1) ELISA Kit

Sign In for Pricing
View Details
Human EXOC1 activation kit by CRISPRa
GA110949 1 Kit

Human EXOC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Trafficking Protein Particle Complex 4 (TRAPPC4) Antibody
abx116142 100 µL

Trafficking Protein Particle Complex 4 (TRAPPC4) Antibody

Sign In for Pricing
View Details