Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2)

This Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2) spans the amino acid sequence from region 24-438.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 2, VIP-R-2, Helodermin-preferring VIP receptor, Pituitary adenylate cyclase-activating polypeptide type III receptor, PACAP typ

UniProt

P41587

Expression Region

24-438

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFY SKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLAT GSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCK LSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAAR LYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQ CELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3 alpha Rabbit Monoclonal antibody
AMRe02064-01 1 Each

GSK3 alpha Rabbit Monoclonal antibody

Sign In for Pricing
View Details
GSK3 alpha Rabbit Monoclonal antibody
AMRe02064-02 50 µL

GSK3 alpha Rabbit Monoclonal antibody

Sign In for Pricing
View Details
GSK3 alpha Rabbit Monoclonal antibody
AMRe02064-03 100 µL

GSK3 alpha Rabbit Monoclonal antibody

Sign In for Pricing
View Details
Anti-CD47/MER6 Antibody (CC-90002) Biosimilar (Monoclonal, IgG4)
A135636 100 µL

Anti-CD47/MER6 Antibody (CC-90002) Biosimilar (Monoclonal, IgG4)

Sign In for Pricing
View Details
S100Z Protein Vector (Mouse) (pPM-C-HA)
42951024 500 ng

S100Z Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PAGE3 ORF Vector (Human) (pORF)
35942011 1.0 µg DNA

PAGE3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details