Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2)

This Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2) spans the amino acid sequence from region 24-438.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 2, VIP-R-2, Helodermin-preferring VIP receptor, Pituitary adenylate cyclase-activating polypeptide type III receptor, PACAP typ

UniProt

P41587

Expression Region

24-438

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFY SKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLAT GSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCK LSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAAR LYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQ CELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acvr2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6814405 3x 1.0 µg

Acvr2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Klebsiella aerogenes, Polysaccharide K15 (K. aerogenes) (MaxLight 405) discontinued
K1891-07-ML405 100 µL

Klebsiella aerogenes, Polysaccharide K15 (K. aerogenes) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Thap11 Mouse siRNA Oligo Duplex (Locus ID 59016)
SR409018 1 Kit

Thap11 Mouse siRNA Oligo Duplex (Locus ID 59016)

Sign In for Pricing
View Details
SH2D3A Antibody, Biotin conjugated
A69249-100UL 100 µL

SH2D3A Antibody, Biotin conjugated

Sign In for Pricing
View Details
Phospho-Ku70 / XRCC6 (Ser5) Rabbit pAb
orb2711198-01 50 µL

Phospho-Ku70 / XRCC6 (Ser5) Rabbit pAb

Sign In for Pricing
View Details
Phospho-Ku70 / XRCC6 (Ser5) Rabbit pAb
orb2711198-02 100 µL

Phospho-Ku70 / XRCC6 (Ser5) Rabbit pAb

Sign In for Pricing
View Details