Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2)

This Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2) spans the amino acid sequence from region 24-438.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 2, VIP-R-2, Helodermin-preferring VIP receptor, Pituitary adenylate cyclase-activating polypeptide type III receptor, PACAP typ

UniProt

P41587

Expression Region

24-438

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFY SKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLAT GSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCK LSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAAR LYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQ CELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TREM2 Protein, C-His
MBS1577955-01 0.1 mg

Recombinant Mouse TREM2 Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse TREM2 Protein, C-His
MBS1577955-02 1 mg

Recombinant Mouse TREM2 Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse TREM2 Protein, C-His
MBS1577955-03 5x 1 mg

Recombinant Mouse TREM2 Protein, C-His

Sign In for Pricing
View Details
Micro tube racks with 1.2 ml tube strips (per metodo visivo clostridia) 10 racks with 96 tubes
62-502360 10 racks with 96 tubes

Micro tube racks with 1.2 ml tube strips (per metodo visivo clostridia) 10 racks with 96 tubes

Sign In for Pricing
View Details
SLC52A1 Antibody
A69068-50UG 50 µg

SLC52A1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TCTN2 Antibody (OTI1C1) [PE/Atto594]
NBP2-74483PEATT594 0.1 mL

Mouse Monoclonal TCTN2 Antibody (OTI1C1) [PE/Atto594]

Sign In for Pricing
View Details