Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vasoactive intestinal polypeptide receptor 2 (Vipr2)

This Recombinant Mouse Vasoactive intestinal polypeptide receptor 2 (Vipr2) spans the amino acid sequence from region 23-437.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 2, VIP-R-2, Pituitary adenylate cyclase-activating polypeptide type III receptor, PACAP type III receptor, PACAP

UniProt

P41588

Expression Region

23-437

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECRFHLEIQEEETKCAELLSSQTENQRACSGVWDNITCWRPADVGETVTVPCPKVFSNFY SRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKISFYILVKAIYTLGYSVSLMSLTT GSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGLLRCHDQPASWVGCK LSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWTATR LSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFELCVGSFQGLVVAVLYCFLNSEVQ CELKRRWRGLCLTQAGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF568 conjugate, 0.1mg/mL
BNC680507-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS500189 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
IL8 (CXCL8) Mouse Monoclonal Antibody [Clone ID: 3E4D8]
AM06083PU-N 100 µL

IL8 (CXCL8) Mouse Monoclonal Antibody [Clone ID: 3E4D8]

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17647-01 50 μL

TAFA1 Antibody

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17647-02 100 µL

TAFA1 Antibody

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17647-03 1 mL

TAFA1 Antibody

Sign In for Pricing
View Details