Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vasoactive intestinal polypeptide receptor 2 (Vipr2)

This Recombinant Mouse Vasoactive intestinal polypeptide receptor 2 (Vipr2) spans the amino acid sequence from region 23-437.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 2, VIP-R-2, Pituitary adenylate cyclase-activating polypeptide type III receptor, PACAP type III receptor, PACAP

UniProt

P41588

Expression Region

23-437

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECRFHLEIQEEETKCAELLSSQTENQRACSGVWDNITCWRPADVGETVTVPCPKVFSNFY SRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKISFYILVKAIYTLGYSVSLMSLTT GSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGLLRCHDQPASWVGCK LSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWTATR LSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFELCVGSFQGLVVAVLYCFLNSEVQ CELKRRWRGLCLTQAGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[2-[(5-carboxypentyl)amino]-2-oxoethyl]-2-hydroxybutanedioic Acid
TRC-C181175-10MG 10 mg

2-[2-[(5-carboxypentyl)amino]-2-oxoethyl]-2-hydroxybutanedioic Acid

Sign In for Pricing
View Details
Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF594 conjugate, 0.1mg/mL
BNC942434-500 1x 500 µL

Guanine nucleotide-binding protein alpha-q / GNAQ / G-ALPHA-q (GNAQ/2434), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863), CF488A conjugate, 0.1mg/mL
BNC880863-500 1x 500 µL

Glypican-3 (GPC3/863), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
7-Amino-3-cephem-4-carboxylic Acid
TRC-A603300-10MG 10 mg

7-Amino-3-cephem-4-carboxylic Acid

Sign In for Pricing
View Details
Actl10 Mouse Gene Knockout Kit (CRISPR)
KN500777 1 Kit

Actl10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Human Gene Knockout Kit (CRISPR)
KN209440 1 Kit

TIM 3 (HAVCR2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details