Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vasoactive intestinal polypeptide receptor 2 (Vipr2)

This Recombinant Rat Vasoactive intestinal polypeptide receptor 2 (Vipr2) spans the amino acid sequence from region 23-437.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 2, VIP-R-2, Pituitary adenylate cyclase-activating polypeptide type III receptor, PACAP type III receptor, PACAP

UniProt

P35000

Expression Region

23-437

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECRFHLEIQEEETKCAELLSSQMENHRACSGVWDNITCWRPADIGETVTVPCPKVFSNFY SRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKITFYILVKAIYTLGYSVSLMSLTT GSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGTLRCHDQPGSWVGCK LSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWIATR LSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFELCVGSFQGLVVAVLYCFLNSEVQ CELKRRWRGLCLTQPGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALT-946 HCl
orb1739421-01 25 mg

ALT-946 HCl

Sign In for Pricing
View Details
ALT-946 HCl
orb1739421-02 50 mg

ALT-946 HCl

Sign In for Pricing
View Details
ALT-946 HCl
orb1739421-03 100 mg

ALT-946 HCl

Sign In for Pricing
View Details
Mouse signal transduction-8 (Smad8) ELISA Kit
YP-W24004-01 48 Tests

Mouse signal transduction-8 (Smad8) ELISA Kit

Sign In for Pricing
View Details
Mouse signal transduction-8 (Smad8) ELISA Kit
YP-W24004-02 96 Tests

Mouse signal transduction-8 (Smad8) ELISA Kit

Sign In for Pricing
View Details
MOBP Antibody - N-terminal region
ARP64245_P050-25UL 25 µL

MOBP Antibody - N-terminal region

Sign In for Pricing
View Details