Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vasoactive intestinal polypeptide receptor 2 (Vipr2)

This Recombinant Rat Vasoactive intestinal polypeptide receptor 2 (Vipr2) spans the amino acid sequence from region 23-437.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 2, VIP-R-2, Pituitary adenylate cyclase-activating polypeptide type III receptor, PACAP type III receptor, PACAP

UniProt

P35000

Expression Region

23-437

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECRFHLEIQEEETKCAELLSSQMENHRACSGVWDNITCWRPADIGETVTVPCPKVFSNFY SRPGNISKNCTSDGWSETFPDFIDACGYNDPEDESKITFYILVKAIYTLGYSVSLMSLTT GSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGTLRCHDQPGSWVGCK LSLVFFQYCIMANFYWLLVEGLYLHTLLVAILPPSRCFLAYLLIGWGIPSVCIGAWIATR LSLEDTGCWDTNDHSIPWWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAAFPIGISSTYQILFELCVGSFQGLVVAVLYCFLNSEVQ CELKRRWRGLCLTQPGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Col1a2 3'UTR GFP Stable Cell Line
TU252613 1.0 mL

Col1a2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Glutamate--cysteine ligase (gshA), partial
MBS1450597 Inquire

Recombinant Pseudomonas putida Glutamate--cysteine ligase (gshA), partial

Sign In for Pricing
View Details
mmu-miR-297c Primers
MPM00283 150 µL - 10 µM

mmu-miR-297c Primers

Sign In for Pricing
View Details
Rat Tumor Susceptibility Gene 101 ELISA Kit
MBS080458-01 48 Well

Rat Tumor Susceptibility Gene 101 ELISA Kit

Sign In for Pricing
View Details
Rat Tumor Susceptibility Gene 101 ELISA Kit
MBS080458-02 96 Well

Rat Tumor Susceptibility Gene 101 ELISA Kit

Sign In for Pricing
View Details
Rat Tumor Susceptibility Gene 101 ELISA Kit
MBS080458-03 5x 96 Well

Rat Tumor Susceptibility Gene 101 ELISA Kit

Sign In for Pricing
View Details