Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Beta-2 adrenergic receptor (ADRB2)

This Recombinant Dog Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

P54833

Expression Region

1-415

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPANRSVFLLAPNGSHAPDQGDSQERSEAWVVGMGIVMSLIVLAIVFGNVLVITAIAR FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAQRQLQKIDRSEGRF HAQNLSQVEQDGRSGHGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSNNSNS RSDYAGEHSGCHLGQEKDSELLCEDPPGTEDRQGTVPSDSVDSQGRNCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS520407 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Docosanoic-22,22,22-d3 Acid
TRC-B119586-25MG 25 mg

Docosanoic-22,22,22-d3 Acid

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF740 conjugate, 0.1mg/mL
BNC743086-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3086), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIAA0100 Human Gene Knockout Kit (CRISPR)
KN423287 1 Kit

KIAA0100 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF640R conjugate, 0.1mg/mL
BNC402480-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2955), CF594 conjugate, 0.1mg/mL
BNC942955-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2955), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details