Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Beta-2 adrenergic receptor (ADRB2)

This Recombinant Dog Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

P54833

Expression Region

1-415

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPANRSVFLLAPNGSHAPDQGDSQERSEAWVVGMGIVMSLIVLAIVFGNVLVITAIAR FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHQE AINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAQRQLQKIDRSEGRF HAQNLSQVEQDGRSGHGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSNNSNS RSDYAGEHSGCHLGQEKDSELLCEDPPGTEDRQGTVPSDSVDSQGRNCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DNAJC14 activation kit by CRISPRa
GA113871 1 Kit

Human DNAJC14 activation kit by CRISPRa

Sign In for Pricing
View Details
PPP3R1 Antibody
OC-2429-01 50 μL

PPP3R1 Antibody

Sign In for Pricing
View Details
PPP3R1 Antibody
OC-2429-02 100 µL

PPP3R1 Antibody

Sign In for Pricing
View Details
PPP3R1 Antibody
OC-2429-03 1 mL

PPP3R1 Antibody

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF568 conjugate, 0.1mg/mL
BNC682342-100 1x 100 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
mLX interacting protein (mLXIP) Human Gene Knockout Kit (CRISPR)
KN422157 1 Kit

mLX interacting protein (mLXIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details