Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1A-beta (htr1a-B)

This Recombinant Takifugu rubripes 5-hydroxytryptamine receptor 1A-beta (htr1a-B) spans the amino acid sequence from region 1-416.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A-beta, 5-HT-1A-beta, 5-HT1A-beta, F1B, Serotonin receptor 1A-beta

UniProt

O42384

Expression Region

1-416

Origin

Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGTNNTTGWTHFDSTSNRTSKSFDEEVKLSYQVVTSFLLGALILCSIFGNACVVAAIAL ERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNRWTLGQIPCDIFISLDMLCCTSS ILHLCVIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISIPPMLIMRSQPSSMA EDRANSKQCKITQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRRTVRKTEKKKV SDTCLALSPAMFHRKTPGDAHGKSWKRSVEPRPLPNVNGAVKHAGEGESLDIIEVQSNSR CNLPLPNTPGTVPLFENRHEKATETKRKIALARERKTVKTLGIIMGTFILCWLPFFIVAL VMPFCQESCFMPHWLKDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCHFCRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM1170), CF640R conjugate, 0.1mg/mL
BNC401170-100 1x 100 µL

Vimentin (VM1170), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF555 conjugate, 0.1mg/mL
BNC551284-500 1x 500 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF740 conjugate, 0.1mg/mL
BNC741563-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details