Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Endothelin B receptor (EDNRB)

This Recombinant Dog Endothelin B receptor (EDNRB) spans the amino acid sequence from region 27-442.

Product Specifications

Product Name Alternative

Endothelin B receptor, ET-B, ET-BR, Endothelin receptor non-selective type

UniProt

P56497

Expression Region

27-442

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTIS PPPCEGSIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALG DLLHIIIDIPITVYKLLAEDWPFGVEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASW SRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAVGFDMITIDYKGRYLRICLLHPTQKTAFM QFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVF CLVLVFALCWLPLHLSRILKLTIYDQNDPNRCELLSFLLVLDYIGINMASLNSCINPIAL YLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOB (N-term) Rabbit Polyclonal Antibody
AP54200PU-N 400 µL

ELOB (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCNYL1 Rabbit Polyclonal Antibody
TA367952 100 µL

CCNYL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP16 (C-term) Rabbit Polyclonal Antibody
AP23329PU-N 100 µg

MMP16 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RIP3 (RIPK3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B3]
TA803100BM 100 µL

RIP3 (RIPK3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS701216 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
rac 5-Hydroxy Valproic Acid-d7 Sodium Salt
TRC-H993012-1MG 1 mg

rac 5-Hydroxy Valproic Acid-d7 Sodium Salt

Sign In for Pricing
View Details