Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide FF receptor 2 (Npffr2)

This Recombinant Mouse Neuropeptide FF receptor 2 (Npffr2) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Neuropeptide FF receptor 2, G-protein coupled receptor 74, Neuropeptide NPFF receptor

UniProt

Q924H0

Expression Region

1-417

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEKWDSNSSESWNHIWSGNDTQHHWYSDINITYVNYYLHQPQVAAVFISSYLLIFVLCM VGNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKI SGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAI MLHVQEEKYYRVRLSSHNKTSTVYWCREDWPRHEMRRIYTTVLFATIYLAPLSLIVIMYA RIGASLFKTAAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYTD LSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAFQICQKKAKPQEAY SLRAKRNIVINTSGLLVQEPVSQNPGGENLGCGKSADNPTQESLIEEMGEATNSTVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Samd8 Mouse Gene Knockout Kit (CRISPR)
KN515279 1 Kit

Samd8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS506290 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
3'-Deoxyadenosine 5’-Monophosphate Triethylamine Salt
TRC-D232025-5MG 5 mg

3'-Deoxyadenosine 5’-Monophosphate Triethylamine Salt

Sign In for Pricing
View Details
SKAR (POLDIP3) (NM_032311) Human Recombinant Protein
TP310583 20 µg

SKAR (POLDIP3) (NM_032311) Human Recombinant Protein

Sign In for Pricing
View Details
Merlin Recombinant Rabbit Monoclonal Antibody [PSH02-52]
HA721828 100 µL

Merlin Recombinant Rabbit Monoclonal Antibody [PSH02-52]

Sign In for Pricing
View Details
PATL2 (NM_001145112) Human Over-expression Lysate
LY428698 100 µg

PATL2 (NM_001145112) Human Over-expression Lysate

Sign In for Pricing
View Details