Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuropeptide FF receptor 2 (Npffr2)

This Recombinant Mouse Neuropeptide FF receptor 2 (Npffr2) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Neuropeptide FF receptor 2, G-protein coupled receptor 74, Neuropeptide NPFF receptor

UniProt

Q924H0

Expression Region

1-417

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEKWDSNSSESWNHIWSGNDTQHHWYSDINITYVNYYLHQPQVAAVFISSYLLIFVLCM VGNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKI SGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVTIVIIWGLAIAIMTPSAI MLHVQEEKYYRVRLSSHNKTSTVYWCREDWPRHEMRRIYTTVLFATIYLAPLSLIVIMYA RIGASLFKTAAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYTD LSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAFQICQKKAKPQEAY SLRAKRNIVINTSGLLVQEPVSQNPGGENLGCGKSADNPTQESLIEEMGEATNSTVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®568 Antibody Labeling Kit, 1x (5-20ug) labeling
#92275 1 Kit

Mix-n-StainTM CF®568 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Ethyl 7-bromoheptanoate
TRC-E900723-5G 5 g

Ethyl 7-bromoheptanoate

Sign In for Pricing
View Details
ECH1 (NM_001398) Human Over-expression Lysate
LY419959 100 µg

ECH1 (NM_001398) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse CXCL12 / SDF-1, Tag Free
HA211308-01 20 µg

Mouse CXCL12 / SDF-1, Tag Free

Sign In for Pricing
View Details
Mouse CXCL12 / SDF-1, Tag Free
HA211308-02 50 µg

Mouse CXCL12 / SDF-1, Tag Free

Sign In for Pricing
View Details
Mouse CXCL12 / SDF-1, Tag Free
HA211308-03 100 µg

Mouse CXCL12 / SDF-1, Tag Free

Sign In for Pricing
View Details