Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Neuropeptide FF receptor 2 (Npffr2)

This Recombinant Rat Neuropeptide FF receptor 2 (Npffr2) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Neuropeptide FF receptor 2, G-protein coupled receptor 74, Neuropeptide G-protein coupled receptor

UniProt

Q9EQD2

Expression Region

1-417

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKRWDSNSSGSWDHIWSGNDTQHPWYSDINITYMNYYLHQPHVTAVFISSYFLIFFLCM VGNTVVCFVVIRNRYMHTVTNFFIFNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKI SGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVMIVIIWGLAITIMTPSAI MLHVQEEKYYRVRLSSHNKTSTVYWCREDWPNQEMRRIYTTVLFATIYLAPLSLIVIMYA RIGASLFKTSAHSTGKQRLEQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYAD LSPNKLRVINIYVYPFAHWLAFCNSSVNPIIYGFFNENFRSGFQDAFQFCQKKVKPQEAY GLRAKRNLDINTSGLLVHEPASQNPSGENLGCRKSADNPTQESLMEETGEATNSTET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KBTBD13 sgRNA CRISPR Lentivector (Human) (Target 2)
K2776403 1.0 µg DNA

KBTBD13 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Seabream hepcidin
HY-P5626 1 Each

Seabream hepcidin

Sign In for Pricing
View Details
Human phospho glycogen synthase kinase 3β (PGSK3β) ELISA Kit
YP-W12666-01 48 Tests

Human phospho glycogen synthase kinase 3β (PGSK3β) ELISA Kit

Sign In for Pricing
View Details
Human phospho glycogen synthase kinase 3β (PGSK3β) ELISA Kit
YP-W12666-02 96 Tests

Human phospho glycogen synthase kinase 3β (PGSK3β) ELISA Kit

Sign In for Pricing
View Details
Human Merozoite Surface Protein 3 (MSP-3) ELISA Kit
abx055775 96 Well

Human Merozoite Surface Protein 3 (MSP-3) ELISA Kit

Sign In for Pricing
View Details
2,3-Dihydroamentoflavone 7,4'-dimethyl ether
orb1683829 5 mg

2,3-Dihydroamentoflavone 7,4'-dimethyl ether

Sign In for Pricing
View Details