Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Neuropeptide FF receptor 2 (Npffr2)

This Recombinant Rat Neuropeptide FF receptor 2 (Npffr2) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Neuropeptide FF receptor 2, G-protein coupled receptor 74, Neuropeptide G-protein coupled receptor

UniProt

Q9EQD2

Expression Region

1-417

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKRWDSNSSGSWDHIWSGNDTQHPWYSDINITYMNYYLHQPHVTAVFISSYFLIFFLCM VGNTVVCFVVIRNRYMHTVTNFFIFNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKI SGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVMIVIIWGLAITIMTPSAI MLHVQEEKYYRVRLSSHNKTSTVYWCREDWPNQEMRRIYTTVLFATIYLAPLSLIVIMYA RIGASLFKTSAHSTGKQRLEQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYAD LSPNKLRVINIYVYPFAHWLAFCNSSVNPIIYGFFNENFRSGFQDAFQFCQKKVKPQEAY GLRAKRNLDINTSGLLVHEPASQNPSGENLGCRKSADNPTQESLMEETGEATNSTET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NXT1 Antibody
NBP2-57120-25ul 25 µL

Rabbit Polyclonal NXT1 Antibody

Sign In for Pricing
View Details
ZIC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
51245066 1.0 µg DNA

ZIC1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RGL3 (NM_001035223) Human Recombinant Protein
PH37009M5 20 µg

RGL3 (NM_001035223) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal PLK1 Antibody (AZ44) [mFluor Violet 500 SE]
NB100-2747MFV500 0.1 mL

Mouse Monoclonal PLK1 Antibody (AZ44) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
WO-28-F Inspection & Calibration Labels
235069 350 Pack (14 Label (s) x 25 Card)

WO-28-F Inspection & Calibration Labels

Sign In for Pricing
View Details
Ceramide synthase 1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb898530 100 µL

Ceramide synthase 1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details