Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromobacterium violaceum UPF0761 membrane protein CV_0810 (CV_0810)

This Recombinant Chromobacterium violaceum UPF0761 membrane protein CV_0810 (CV_0810) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

UPF0761 membrane protein CV_0810

UniProt

Q7NZV9

Expression Region

1-417

Origin

Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPLLRGGFGITFAAMQVQRLEPYFGFARFIARRMSCLRVLQISGSLTFTTLLALVPLFT IALSVISAFPVFSDYSTRFKIMLLSTLVPEFAGKVITVYMRQFADNAEKLTAAGIVMLGV TALMLMSTIERTFNAIWGVRRGRPWLQQSMVYWTVLTLGPLVLGGSLLSWRWLFKATRLE KNLPLLASVLEAGGTIVLTALVLALLYRIVPNRFVPFRHAVWGALVTSVLLELTKMGFGF YIGQVASYQLVYGAFASIPIFLLWVYCLWLVVLAGAVFTSALSYWEGDAWRRRNEPHRRF QDALEVLLLLDAAHARGEALTPRQLRQQVKVGYDELGLVLDRLAQRGYVQKGHGDAWVLM RRAAAINLSDLFQIFVYRRDASAGDALDATLAELLGPLTEQLQAVTVADLARRVGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL
BNC680960-100 1x 100 µL

MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF740 conjugate, 0.1mg/mL
BNC740802-500 1x 500 µL

CD35 / CR1 (CR1/802), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details