Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Beta-2 adrenergic receptor (ADRB2)

This Recombinant Bovine Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q28044

Expression Region

1-418

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS54 3'UTR GFP Stable Cell Line
TU068978 1.0 mL

PRSS54 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
COQ6 Polyclonal Antibody
CAC14806-01 50 µg

COQ6 Polyclonal Antibody

Sign In for Pricing
View Details
COQ6 Polyclonal Antibody
CAC14806-02 100 µg

COQ6 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Rat Kappa Light Chain (MAR 18.5) In Vivo Antibody - Ultra-Low Endotoxin
ICH1207UL-25mg 25 mg

Anti-Rat Kappa Light Chain (MAR 18.5) In Vivo Antibody - Ultra-Low Endotoxin

Sign In for Pricing
View Details
Fish Ras-Related Protein Rab-7L1 (RAB7L1) ELISA Kit
MBS9358826 Inquire

Fish Ras-Related Protein Rab-7L1 (RAB7L1) ELISA Kit

Sign In for Pricing
View Details
PDGFRB Recombinant Monoclonal Antibody
CSB-RA213932A0HU-01 50 μL

PDGFRB Recombinant Monoclonal Antibody

Sign In for Pricing
View Details