Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Beta-2 adrenergic receptor (ADRB2)

This Recombinant Bovine Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q28044

Expression Region

1-418

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Maltose Binding Protein malE Rabbit Monoclonal Antibody, Carrier-free
M30934-1-carrier-free 100 µL

Anti-Maltose Binding Protein malE Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Rasgef1c (NM_029004) Mouse Recombinant Protein
E45M44040M5 20 µg

Rasgef1c (NM_029004) Mouse Recombinant Protein

Sign In for Pricing
View Details
Luzp5 3'UTR Luciferase Stable Cell Line
TU212666 1.0 mL

Luzp5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Human CCL11/Eotaxin Antibody (SAA0458), PerCP
MBS1584324-01 50 Tests

Anti-Human CCL11/Eotaxin Antibody (SAA0458), PerCP

Sign In for Pricing
View Details
Anti-Human CCL11/Eotaxin Antibody (SAA0458), PerCP
MBS1584324-02 100 Tests

Anti-Human CCL11/Eotaxin Antibody (SAA0458), PerCP

Sign In for Pricing
View Details
Anti-Human CCL11/Eotaxin Antibody (SAA0458), PerCP
MBS1584324-03 5x 100 Tests

Anti-Human CCL11/Eotaxin Antibody (SAA0458), PerCP

Sign In for Pricing
View Details