Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Beta-2 adrenergic receptor (ADRB2)

This Recombinant Bovine Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q28044

Expression Region

1-418

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr679 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4288207 1.0 µg DNA

Olfr679 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
GPR25 Antibody
OAAJ05844-100UL 100 µL

GPR25 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 7/17 Antibody (C-46) [Alexa Fluor 532]
NB500-352AF532 0.1 mL

Mouse Monoclonal Cytokeratin 7/17 Antibody (C-46) [Alexa Fluor 532]

Sign In for Pricing
View Details
Endothelin-2 (EDN2) Cat ELISA Kit
D1785 96 Tests

Endothelin-2 (EDN2) Cat ELISA Kit

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 2 (GSTa2)
MBS2061036-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 2 (GSTa2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 2 (GSTa2)
MBS2061036-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Glutathione S Transferase Alpha 2 (GSTa2)

Sign In for Pricing
View Details