Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tscherskia triton Beta-2 adrenergic receptor (ADRB2)

This Recombinant Tscherskia triton Beta-2 adrenergic receptor (ADRB2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

Q4KWL2

Expression Region

1-418

Origin

Tscherskia triton (Greater long-tailed hamster)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPPGNDSDFLLTPNGSHTPDHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYIAITSPFKYQSLLTKNKARMVILMVWIVSGLTSFLPIQMHWYRATHEK AITCYRNETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HSQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQE NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSAKAYGNGYSSNSNG KSDYMGEASECQLRQEKESELLCEDPPGMESFANCQGTVPSLSLDSQGRNCSTNDSPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL
BNC682167-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF640R conjugate, 0.1mg/mL
BNC400396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details