Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Delta (14) -sterol reductase (TM7SF2)

This Recombinant Bovine Delta (14) -sterol reductase (TM7SF2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Delta (14) -sterol reductase, Delta-14-SR, EC= 1.3.1.70, C-14 sterol reductase, Sterol C14-reductase, Transmembrane 7 superfamily member 2

UniProt

Q8WMV1

Expression Region

1-418

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPPQGSRAPLEFGGPLGAAALMLLLPVTMFHLLLVARSGPARLLGPPPYLPGPEELWSP WALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLRYPTNGFQALVLTALLVGLGVSAG LPLSALPEMLLPLAFAATLTAFIFSLLLYLKALLAPASALAPGGNSGNLIYDFFLGRELN PRICSFDFKYFCELRPGLIGWVLINLALLIQEAELRGSPSLAMWLVNGFQLLYVGDALWY EEAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGWPLASFICLINAVG YYIFRGANSQKNTFRKNPSDPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALA WSLPCGVFHLLPYFYFLYFTALLVHREDRDERQCRQKYGLAWHEYCRRVPYRIVPYVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (BSG/963), CF647 conjugate, 0.1mg/mL
BNC470963-500 1x 500 µL

CD147 (BSG/963), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (HLA-DRB/1067), CF488A conjugate, 0.1mg/mL
BNC881067-100 1x 100 µL

HLA-DRB (HLA-DRB/1067), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details