Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative odorant receptor 13a (Or13a)

This Recombinant Drosophila melanogaster Putative odorant receptor 13a (Or13a) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Putative odorant receptor 13a

UniProt

Q9VXL0

Expression Region

1-418

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFYSYPYKALSFPIQCVWLKLNGSWPLTESSRPWRSQSLLATAYIVWAWYVIASVGITIS YQTAFLLNNLSDIIITTENCCTTFMGVLNFVRLIHLRLNQRKFRQLIENFSYEIWIPNSS KNNVAAECRRRMVTFSIMTSLLACLIIMYCVLPLVEIFFGPAFDAQNKPFPYKMIFPYDA QSSWIRYVMTYIFTSYAGICVVTTLFAEDTILGFFITYTCGQFHLLHQRIAGLFAGSNAE LAESIQLERLKRIVEKHNNIISFAKRLEDFFNPILLANLMISSVLICMVGFQIVTGKNMF IGDYVKFIIYISSALSQLYVLCENGDALIKQSTLTAQILYECQWEGSDRIEIQSFTPTTK RIRNQIWFMILCSQQPVRITAFKFSTLSLQSFTAILSTSISYFTLLRSVYFDDEKKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF568 conjugate, 0.1mg/mL
BNC681786-500 1x 500 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF568 conjugate, 0.1mg/mL
BNC680931-100 1x 100 µL

CD46 (197-2B1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details