Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-2 adrenergic receptor (Adrb2)

This Recombinant Mouse Beta-2 adrenergic receptor (Adrb2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

P18762

Expression Region

1-418

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK FERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKK AIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRD NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG RTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTVPSLSVDSQGRNCSTNDSPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGP2 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-4043R-PE-Cy5.5 100 µL

UGP2 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mitochondria (AP)
MBS6241746-01 0.1 mL

Mitochondria (AP)

Sign In for Pricing
View Details
Mitochondria (AP)
MBS6241746-02 5x 0.1 mL

Mitochondria (AP)

Sign In for Pricing
View Details
Proteasome Assembly Chaperone 2 (PSMG2) Antibody
abx236899 100 µg

Proteasome Assembly Chaperone 2 (PSMG2) Antibody

Sign In for Pricing
View Details
Sheep Mitochondrial Respiratory Chain Complex V ELISA Kit
GTR10413391 96 Well

Sheep Mitochondrial Respiratory Chain Complex V ELISA Kit

Sign In for Pricing
View Details
Tbc1d15 Mouse qPCR Template Standard (NM_025706)
MK201455 1 Kit

Tbc1d15 Mouse qPCR Template Standard (NM_025706)

Sign In for Pricing
View Details