Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-2 adrenergic receptor (Adrb2)

This Recombinant Mouse Beta-2 adrenergic receptor (Adrb2) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Beta-2 adrenergic receptor, Beta-2 adrenoreceptor, Beta-2 adrenoceptor

UniProt

P18762

Expression Region

1-418

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK FERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKK AIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF HAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRD NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG RTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTVPSLSVDSQGRNCSTNDSPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl37 3'UTR Lenti-reporter-Luc Vector
30478086 1.0 µg

Mrpl37 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Candida albicans Candidapepsin-2 (SAP2)
CSB-EP505575CZE-01 20 µg

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Sign In for Pricing
View Details
Recombinant Candida albicans Candidapepsin-2 (SAP2)
CSB-EP505575CZE-02 100 µg

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Sign In for Pricing
View Details
Recombinant Candida albicans Candidapepsin-2 (SAP2)
CSB-EP505575CZE-03 1 mg

Recombinant Candida albicans Candidapepsin-2 (SAP2)

Sign In for Pricing
View Details
Ɑ-Biotinamido-ω-Squaric Acid Ester Amido PEG
1320000-25-50.1G 1 g

Ɑ-Biotinamido-ω-Squaric Acid Ester Amido PEG

Sign In for Pricing
View Details
AKR1C3 (Aldo-keto Reductase Family 1 Member C3, DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, KIAA0119, hluPGFS) (MaxLight 405)
MBS6406019-01 0.1 mL

AKR1C3 (Aldo-keto Reductase Family 1 Member C3, DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, KIAA0119, hluPGFS) (MaxLight 405)

Sign In for Pricing
View Details