Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 3 (SSTR3)

This Recombinant Human Somatostatin receptor type 3 (SSTR3) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Somatostatin receptor type 3, SS-3-R, SS3-R, SS3R, SSR-28

UniProt

P32745

Expression Region

1-418

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (B-K29) [DyLight 594]
NBP3-14595DL594 0.1 mL

Mouse Monoclonal TRAILR2/TNFRSF10B Antibody (B-K29) [DyLight 594]

Sign In for Pricing
View Details
Porcine Armadillo repeat-containing protein 2 ELISA Kit
MBS7223932-01 48 Well

Porcine Armadillo repeat-containing protein 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Armadillo repeat-containing protein 2 ELISA Kit
MBS7223932-02 96 Well

Porcine Armadillo repeat-containing protein 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Armadillo repeat-containing protein 2 ELISA Kit
MBS7223932-03 5x 96 Well

Porcine Armadillo repeat-containing protein 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Armadillo repeat-containing protein 2 ELISA Kit
MBS7223932-04 10x 96 Well

Porcine Armadillo repeat-containing protein 2 ELISA Kit

Sign In for Pricing
View Details
FCAMR Rabbit Polyclonal Antibody (PerCP)
orb2503603 100 µL

FCAMR Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details