Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 3 (SSTR3)

This Recombinant Human Somatostatin receptor type 3 (SSTR3) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Somatostatin receptor type 3, SS-3-R, SS3-R, SS3R, SSR-28

UniProt

P32745

Expression Region

1-418

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POMGNT1 Protein Vector (Mouse) (pPB-C-His)
PV217946 500 ng

POMGNT1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CMTM8 Antibody
E38PA7337 100 µL

CMTM8 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD45.2 Monoclonal Antibody
MBS2556942-01 0.025 mg

Purified Anti-Mouse CD45.2 Monoclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD45.2 Monoclonal Antibody
MBS2556942-02 0.1 mg

Purified Anti-Mouse CD45.2 Monoclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD45.2 Monoclonal Antibody
MBS2556942-03 1 mg

Purified Anti-Mouse CD45.2 Monoclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD45.2 Monoclonal Antibody
MBS2556942-04 5 mg

Purified Anti-Mouse CD45.2 Monoclonal Antibody

Sign In for Pricing
View Details