Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 3 (SSTR3)

This Recombinant Human Somatostatin receptor type 3 (SSTR3) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Somatostatin receptor type 3, SS-3-R, SS3-R, SS3R, SSR-28

UniProt

P32745

Expression Region

1-418

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUF1 CRISPR/Cas9 KO Plasmid (m)
sc-433051 20 µg

GUF1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Zebrafish IDH3B Rabbit Polyclonal Antibody (HRP)
orb2804932 100 µg

Zebrafish IDH3B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ING1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-1291R-BF350 100 µL

ING1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
NSMCE2 Protein Vector (Mouse) (pPB-C-His)
PV206866 500 ng

NSMCE2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
LOC100360835 3'UTR GFP Stable Cell Line
TU257726 1.0 mL

LOC100360835 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
UNC5D Antibody
CSB-PA740925LA01HU-01 50 µg

UNC5D Antibody

Sign In for Pricing
View Details