Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Melatonin receptor type 1C (mtnr1c)

This Recombinant Xenopus laevis Melatonin receptor type 1C (mtnr1c) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Melatonin receptor type 1C, Mel-1C-R, Mel1c (alpha) receptor, Mel1c receptor

UniProt

P49219

Expression Region

1-420

Origin

Xenopus laevis (African clawed frog)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMEVNSTCLDCRTPGTIRTEQDAQDSASQGLTSALAVVLIFTIVVDVLGNILVILSVLRN KKLQNAGNLFVVSLSIADLVVAVYPYPVILIAIFQNGWTLGNIHCQISGFLMGLSVIGSV FNITAIAINRYCYICHSLRYDKLYNQRSTWCYLGLTWILTIIAIVPNFFVGSLQYDPRIF SCTFAQTVSSSYTITVVVVHFIVPLSVVTFCYLRIWVLVIQVKHRVRQDFKQKLTQTDLR NFLTMFVVFVLFAVCWAPLNFIGLAVAINPFHVAPKIPEWLFVLSYFMAYFNSCLNAVIY GVLNQNFRKEYKRILMSLLTPRLLFLDTSRGGTEGLKSKPSPAVTNNNQADMLGEARSLW LSRRNGAKMVIIIRPRKAQIAIIHQIFWPQSSWATCRQDTKITGEEDGCRELCKDGISQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-500 1x 500 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-500 1x 500 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF568 conjugate, 0.1mg/mL
BNC682867-500 1x 500 µL

CD59 / Complement Regulatory Protein / Protectin (MACIF/2867R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL
BNC042428-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details