Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eisenia foetida Annetocin receptor (anr)

This Recombinant Eisenia foetida Annetocin receptor (anr) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Annetocin receptor

UniProt

Q75W84

Expression Region

1-420

Origin

Eisenia foetida (Common brandling worm) (Common dung-worm)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMDDDEAILLDDIYALASTPNQTIVTSSFPQTVSPGFLARRNEALAMVEVAVQSTILIL TVVGNAAVLAMIVSLSRHKDLGRMYTMIGHLSCADLFVAIFNLLPQLLWDVTHRFRGGRV LCKLVKYVQVVAMYASAYVLMSTAVDRYTAICHPMRSHTWTSTTAHYLVIGAWVLALVFA VPQLVIFDYVEVVPGSGVYDCVDHFRPRWTLPVYITWFALAVYVIPLVVLATIYLRICVV VWKSANRKSTPMINVAARTSGATEQPSLDDASVSFNVADGGGVDLDPSGGGGSLSRHAAQ LSHRQQQQQANNVVLSRAKTKTVKLTLTVVISYLVCWAPFFVSHIWSAWDPHAPFEGTEM VITLLLGSLNSCINPWIYLAFSDQLRRKVTQCCPRSWGQRPSTLSHDSTDFRSGSRPTHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details