Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Microtus montanus Vasopressin V1a receptor (Avpr1a)

This Recombinant Microtus montanus Vasopressin V1a receptor (Avpr1a) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Vasopressin V1a receptor, V1aR, AVPR V1a, Antidiuretic hormone receptor 1a, Vascular/hepatic-type arginine vasopressin receptor

UniProt

Q9WTV8

Expression Region

1-420

Origin

Microtus montanus (Montane vole)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFPRGSYDPAASNSSPRWPLSAEDANSSREAAGHQKGSDPSGDVRNEELAKLEIAVLAV IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP DWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWVLSFL LSTPQYFIFSMIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSGVFVVPVVILGTCYGF ICYHIWRNVRGKTASRQSKGSGEDVAPFHKGLLVTPCVSSVKTISRAKIRTVKMTFVIVT AYILCWAPFFIVQMWSVWDDNFIWTDSENPSITITALLASLNSCCNPWIYMFFSGHLLQD CVQSFPCCQRMVQKFTKDDSDNMSRRQTSYSNNRSPTNSTGTWKDSPKSSRSIRFIPVST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL
BNC882579-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details