Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse 5-hydroxytryptamine receptor 1A (HTR1A)

This Recombinant Horse 5-hydroxytryptamine receptor 1A (HTR1A) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A, 5-HT-1A, 5-HT1A, Serotonin receptor 1A

UniProt

Q0EAB6

Expression Region

1-422

Origin

Equus caballus (Horse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLGPGQGNNTTSSEGPFGTRANATGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLVGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGADS RLGASPAPQRKKSANGELGSREWRQGVENKAGGVLCANGAVRQGDDGAALEVIEVHRMGN SKEHLPLPSEAGAIPCAPAFFEKKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKILKCKFC RR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cathepsin S/CTSS Protein (His Tag)
PKSH033736-01 10 µg

Recombinant Human Cathepsin S/CTSS Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cathepsin S/CTSS Protein (His Tag)
PKSH033736-02 50 µg

Recombinant Human Cathepsin S/CTSS Protein (His Tag)

Sign In for Pricing
View Details
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF740 conjugate, 0.1mg/mL
BNC743168-500 1x 500 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504703 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
FBXO7 (NM_001033024) Human Over-expression Lysate
LC422341 20 µg

FBXO7 (NM_001033024) Human Over-expression Lysate

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF640R conjugate, 0.1mg/mL
BNC400708-500 1x 500 µL

Kappa Light Chain (TB28-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details