Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 151 protein (Gpr151)

This Recombinant Mouse Probable G-protein coupled receptor 151 protein (Gpr151) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 151 protein, G-protein coupled receptor PGR7, GPCR-2037

UniProt

Q7TSN6

Expression Region

1-422

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKAMLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPSLLMAVCLVGLVGNLC VIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYSKGVWDLGWFICKSSDW FTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLAGIWVVASLLPLPEWLFS TTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLAGVYFWRAYDQCKTRCTKT RNLRDQMRSKQLTVMLLSTAIISALLWLPEWIAWLWVWHVKAGGPMPPQGFIALSQVLMF FTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQEAPAGNTEALPGKAPSPETQ TCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDAVPSAQDNDPIPWEHEGQETEG CN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYMP Antibody
A37783-100UL 100 µL

TYMP Antibody

Sign In for Pricing
View Details
AP-2-alpha Antibody
E51A11681 100 µL

AP-2-alpha Antibody

Sign In for Pricing
View Details
Prostate Secretory Protein (PSP, Beta-microseminoprotein [Precursor], Immunoglobulin Binding Factor, IGBF, PN44, Prostate Secreted Seminal Plasma Protein, Prostate Secretory Protein PSP94, PSP94, Seminal Plasma beta Inhibin) (PE) discontinued
P9054-06C-PE 100 µL

Prostate Secretory Protein (PSP, Beta-microseminoprotein [Precursor], Immunoglobulin Binding Factor, IGBF, PN44, Prostate Secreted Seminal Plasma Protein, Prostate Secretory Protein PSP94, PSP94, Seminal Plasma beta Inhibin) (PE) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ALDH9A1 Antibody [CoraFluor 1]
NBP2-99130CL1 0.1 mL

Rabbit Polyclonal ALDH9A1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
CaMK1-beta Antibody
MBS9505299-01 0.05 mL

CaMK1-beta Antibody

Sign In for Pricing
View Details
CaMK1-beta Antibody
MBS9505299-02 0.1 mL

CaMK1-beta Antibody

Sign In for Pricing
View Details