Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 151 protein (Gpr151)

This Recombinant Mouse Probable G-protein coupled receptor 151 protein (Gpr151) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 151 protein, G-protein coupled receptor PGR7, GPCR-2037

UniProt

Q7TSN6

Expression Region

1-422

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKAMLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPSLLMAVCLVGLVGNLC VIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYSKGVWDLGWFICKSSDW FTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLAGIWVVASLLPLPEWLFS TTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLAGVYFWRAYDQCKTRCTKT RNLRDQMRSKQLTVMLLSTAIISALLWLPEWIAWLWVWHVKAGGPMPPQGFIALSQVLMF FTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQEAPAGNTEALPGKAPSPETQ TCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDAVPSAQDNDPIPWEHEGQETEG CN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP-S16 HDR Plasmid (h)
sc-412092-HDR 20 µg

MRP-S16 HDR Plasmid (h)

Sign In for Pricing
View Details
Anti-Cytochrome P450 Reductase/POR Antibody Picoband® Fluoro488 Conjugated
PA1952-Fluoro488 100 µg/Vial

Anti-Cytochrome P450 Reductase/POR Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Phospho-STAT1 (Tyr701) Rabbit Polyclonal Antibody (BF350)
orb2498597 100 µL

Phospho-STAT1 (Tyr701) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Standard grade - 55, Dia/Size in cm 9 Re
0550-0900-100C 1 unit

Standard grade - 55, Dia/Size in cm 9 Re

Sign In for Pricing
View Details
PTP alpha (PTPRA) (NM_080841) Human Mass Spec Standard
PH304392 10 µg

PTP alpha (PTPRA) (NM_080841) Human Mass Spec Standard

Sign In for Pricing
View Details
PEMT Adenovirus (Mouse)
36384054 1.0 mL

PEMT Adenovirus (Mouse)

Sign In for Pricing
View Details